Mouse Anti-Hamsters Bst2 Antibody (MO-AB-42972W)


Cat: MO-AB-42972W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHamsters (Cricetinae)
CloneMO42972W
SpecificityThis antibody binds to Hamsters Bst2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Golgi apparatus; Endosome; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionBone marrow stromal cells are involved in the growth and development of B-cells. The specific function of the protein encoded by the bone marrow stromal cell antigen 2 is undetermined; however, this protein may play a role in pre-B-cell growth and in rheumatoid arthritis.
Product OverviewMouse Anti-Hamsters Bst2 Antibody is a mouse antibody against Bst2. It can be used for Bst2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBone marrow stromal antigen 2; BST-2; Luminal membrane-associated protein GREG; CD antigen CD317; Bst2
UniProt IDQ6WRU0
Protein RefseqThe length of the protein is203 amino acids long.
The sequence is show below: MAPTFYHYHPLPMDQKEPGCGIRWRCLAAASVLILVALVIPLIIFAVKANSEACRDGLRAQEECSNTTRLLQRQLTRSQDNLAQAEAQASTCNRTVVTLQDSLEKKVSQIQEKQALIQEQEAQIKEQEAQIKEQEAQIKEQKAHIQEQQVRIQKLEGEVEEFEQKLKKLRTAEEASITSKQNSAGSMAVSSLLVLAVPLFLLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry