Mouse Anti-HARS Antibody (CBMOAB-44350FYA)


Cat: CBMOAB-44350FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44350FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO44350FYA 100 µg
CBMOAB-79075FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79075FYA 100 µg
MO-AB-11815W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO11815W 100 µg
MO-AB-56578W Monoclonal Marmoset WB, ELISA MO56578W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO44350FYA
SpecificityThis antibody binds to Rhesus HARS.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a cytoplasmic enzyme which belongs to the class II family of aminoacyl-tRNA synthetases. The enzyme is responsible for the synthesis of histidyl-transfer RNA, which is essential for the incorporation of histidine into proteins. The gene is located in a head-to-head orientation with HARSL on chromosome five, where the homologous genes share a bidirectional promoter. The gene product is a frequent target of autoantibodies in the human autoimmune disease polymyositis/dermatomyositis. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus HARS Antibody is a mouse antibody against HARS. It can be used for HARS detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHARS
UniProt IDF7GIE0
Protein RefseqThe length of the protein is 174 amino acids long.
The sequence is show below: MAERAALEELVKLQGERVRGLKQQKASAELIEEEVGKLLKLKAQLGPDESKQKFVLKTPKGTRDYSPRQMAVREKVFDVIIRCFKRHGAEVIDTPVFELKETLMGKYGEDSKLIYDLKDQGGELLSLRYDLTVPFARYLAMNKLTNIKRYHIAKVYRRDNPAMTRGRYREFYQC.
For Research Use Only | Not For Clinical Use.
Online Inquiry