AibGenesis™ Mouse Anti-hax1 Antibody (CBMOAB-79107FYA)
Cat: CBMOAB-79107FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-79107FYA | Monoclonal | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) | WB, ELISA | MO79107FYA | 100 µg | ||
| MO-AB-04172H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04172C | 100 µg | ||
| MO-AB-13550R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13550R | 100 µg | ||
| MO-AB-24078W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO24078W | 100 µg | ||
| MO-AB-26236H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26236C | 100 µg | ||
| MO-AB-45009W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45009W | 100 µg | ||
| MO-AB-56592W | Monoclonal | Marmoset | WB, ELISA | MO56592W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Horse (Equus caballus), Marmoset, Rat (Rattus norvegicus) |
| Clone | MO79107FYA |
| Specificity | This antibody binds to Zebrafish hax1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Zebrafish hax1 Antibody is a mouse antibody against hax1. It can be used for hax1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Zgc:92196; hax1; zgc:9219 |
| UniProt ID | Q6DHN8 |
| Protein Refseq | The length of the protein is 286 amino acids long. The sequence is show below: MSVFDLFRGFFGVPGGHYREDGRRDPFFDGMIHEDDDDEDEDDFNRPHRDPFDDAFRFGFSFGPGGARFEEPQMFGQIFRDMEEMFAGLGRFDERHGFGPRGFPSIEAPPPQEGVEKGRSGTGSGNPIRDFMLKSPDRSPKDPEHREDSPPNHPHRRPFSKFNDIWKDGLLKPKGEDKREDGDLDSQVSSGGLDQILKDPAPSQPKTRSFFKSVSVTKVVRPDGTVEERRTVRDGEGNEETTVTISERPGGQDRPVLDQSGPLMPGGSDMQDDFSMFSKFFRGFRS. |
For Research Use Only | Not For Clinical Use.
Online Inquiry