Mouse Anti-HB1 Antibody (CBMOAB-23061FYB)


Cat: CBMOAB-23061FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-23061FYB Monoclonal Rice (Oryza), Cottonwood (Populus deltoids) WB, ELISA MO23061FYB 100 µg
MO-AB-27659W Monoclonal Cottonwood (Populus deltoids) WB, ELISA MO27659W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRice (Oryza), Cottonwood (Populus deltoids)
CloneMO23061FYB
SpecificityThis antibody binds to Rice HB1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rice HB1 Antibody is a mouse antibody against HB1. It can be used for HB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNon-symbiotic hemoglobin 1; ORYsa GLB1a; rHb1; HB1; GLB1A; Os03g0233900 LOC_Os03g13140
UniProt IDO04986
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MALVEDNNAVAVSFSEEQEALVLKSWAILKKDSANIALRFFLKIFEVAPSASQMFSFLRNSDVPLEKNPKLKTHAMSVFVMTCEAAAQLRKAGKVTVRDTTLKRLGATHLKYGVGDAHFEVVKFALLDTIKEEVPADMWSPAMKSAWSEAYDHLVAAIKQEMKPAE.
For Research Use Only | Not For Clinical Use.
Online Inquiry