Mouse Anti-HBA1 Antibody (CBMOAB-44381FYA)
Cat: CBMOAB-44381FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-44381FYA | Monoclonal | Rhesus (Macaca mulatta), Bovine, Mouse, Frog (Xenopus laevis), Goat (Capra hircus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, ELISA | MO44381FYA | 100 µg | ||
MO-AB-04173H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04173C | 100 µg | ||
MO-AB-08318Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08318Y | 100 µg | ||
MO-AB-11588Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO11588Y | 100 µg | ||
MO-AB-26242H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26242C | 100 µg | ||
MO-AB-37400W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37400W | 100 µg | ||
MOFY-0722-FY353 | Polyclonal | Bovine, Mouse | WB, IHC, ICC, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Bovine, Mouse, Frog (Xenopus laevis), Goat (Capra hircus), O. mykiss (Oncorhynchus mykiss), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) |
Clone | MO44381FYA |
Specificity | This antibody binds to Rhesus HBA1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. (From NCBI) |
Product Overview | Mouse Anti-Rhesus HBA1 Antibody is a mouse antibody against HBA1. It can be used for HBA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Hemoglobin subunit alpha; HBA1 |
UniProt ID | I2CVH9 |
Protein Refseq | The length of the protein is 142 amino acids long. The sequence is show below: MVLSPADKTNVKAAWGKVGGHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTLAVGHVDDMPQALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry