AibGenesis™ Mouse Anti-HBG2 Antibody (CBMOAB-44385FYA)


Cat: CBMOAB-44385FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44385FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus) WB, ELISA MO44385FYA 100 µg
MO-AB-08325Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08325Y 100 µg
MO-AB-27141W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO27141W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Rabbit (Oryctolagus cuniculus)
CloneMO44385FYA
SpecificityThis antibody binds to Rhesus HBG2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe gamma globin genes (HBG1 and HBG2) are normally expressed in the fetal liver, spleen and bone marrow. Two gamma chains together with two alpha chains constitute fetal hemoglobin (HbF) which is normally replaced by adult hemoglobin (HbA) at birth. In some beta-thalassemias and related conditions, gamma chain production continues into adulthood. The two types of gamma chains differ at residue 136 where glycine is found in the G-gamma product (HBG2) and alanine is found in the A-gamma product (HBG1). The former is predominant at birth. The order of the genes in the beta-globin cluster is: 5'- epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. (From NCBI)
Product OverviewMouse Anti-Rhesus HBG2 Antibody is a mouse antibody against HBG2. It can be used for HBG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHBG2
UniProt IDF7HAW8
Protein RefseqThe length of the protein is 158 amino acids long.
The sequence is show below: MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKNLDDLKGTFAQLSELHCDKLHVDPENFRLLGNVLVTVLAIYFGKEFTPEVQASWQKMVWSGQCPVLQIPLSPLPTMQSFQG.
For Research Use Only | Not For Clinical Use.
Online Inquiry