AibGenesis™ Mouse Anti-HBQ1 Antibody (CBMOAB-44387FYA)


Cat: CBMOAB-44387FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44387FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Horse (Equus caballus) WB, ELISA MO44387FYA 100 µg
MO-AB-13560R Monoclonal Cattle (Bos taurus) WB, ELISA MO13560R 100 µg
MO-AB-45014W Monoclonal Horse (Equus caballus) WB, ELISA MO45014W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Horse (Equus caballus)
CloneMO44387FYA
SpecificityThis antibody binds to Rhesus HBQ1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HBQ1 Antibody is a mouse antibody against HBQ1. It can be used for HBQ1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHBQ1
UniProt IDF7C7G9
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: MALSAEDRALVRALWKKLGSNVGVYATEALERTFLAFPATKTYFSHLDLSPGSAQVRAHGQKVADALSLAVERLDDLPRALSALSHLHACQLRVDPANFPLLGHCLLVTLARHYPGDFSPALQASLDKFLSHVISALASEYR.
For Research Use Only | Not For Clinical Use.
Online Inquiry