Mouse Anti-HBZ1 Antibody (MO-AB-45015W)


Cat: MO-AB-45015W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-45015W Monoclonal Horse (Equus caballus), Goat (Capra hircus) WB, ELISA MO45015W 100 µg
MO-AB-37407W Monoclonal Goat (Capra hircus) WB, ELISA MO37407W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus), Goat (Capra hircus)
CloneMO45015W
SpecificityThis antibody binds to Horse HBZ1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Horse HBZ1 Antibody is a mouse antibody against HBZ1. It can be used for HBZ1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHemoglobin subunit zeta; Hemoglobin zeta chain; Zeta-globin; HBZ1
UniProt IDP13787
Protein RefseqThe length of the protein is142 amino acids long.
The sequence is show below: MSLTKAERTMVVSIWGKISMQADAVGTEALQRLFSSYPQTKTYFPHFDLHEGSPQLRAHGSKVAAAVGDAVKSIDNVAGALAKLSELHAYILRVDPVNFKFLSHCLLVTLASRLPADFTADAHAAWDKFLSIVSSVLTEKYR.
For Research Use Only | Not For Clinical Use.
Online Inquiry