AibGenesis™ Mouse Anti-HCST Antibody (CBMOAB-44402FYA)
Cat: CBMOAB-44402FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44402FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, ELISA | MO44402FYA | 100 µg | ||
| CBMOAB-79182FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO79182FYA | 100 µg | ||
| MO-AB-04191H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04191C | 100 µg | ||
| MO-AB-13578R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13578R | 100 µg | ||
| MO-AB-26257H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26257C | 100 µg | ||
| MO-AB-56612W | Monoclonal | Marmoset | WB, ELISA | MO56612W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) |
| Clone | MO44402FYA |
| Specificity | This antibody binds to Rhesus HCST. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a transmembrane signaling adaptor that contains a YxxM motif in its cytoplasmic domain. The encoded protein may form part of the immune recognition receptor complex with the C-type lectin-like receptor NKG2D. As part of this receptor complex, this protein may activate phosphatidylinositol 3-kinase dependent signaling pathways through its intracytoplasmic YxxM motif. This receptor complex may have a role in cell survival and proliferation by activation of NK and T cell responses. Alternative splicing results in two transcript variants encoding different isoforms. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus HCST Antibody is a mouse antibody against HCST. It can be used for HCST detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Hematopoietic cell signal transducer; HCST |
| UniProt ID | F7AQW3 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MIHPGHILFLLLLPVAAAQTTPGERSLLAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGVVFLCARPRRSPAQEDGKVYINMPGRG. |
For Research Use Only | Not For Clinical Use.
Online Inquiry