Mouse Anti-HCST Antibody (CBMOAB-44402FYA)


Cat: CBMOAB-44402FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44402FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO44402FYA 100 µg
CBMOAB-79182FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79182FYA 100 µg
MO-AB-04191H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04191C 100 µg
MO-AB-13578R Monoclonal Cattle (Bos taurus) WB, ELISA MO13578R 100 µg
MO-AB-26257H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26257C 100 µg
MO-AB-56612W Monoclonal Marmoset WB, ELISA MO56612W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO44402FYA
SpecificityThis antibody binds to Rhesus HCST.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a transmembrane signaling adaptor that contains a YxxM motif in its cytoplasmic domain. The encoded protein may form part of the immune recognition receptor complex with the C-type lectin-like receptor NKG2D. As part of this receptor complex, this protein may activate phosphatidylinositol 3-kinase dependent signaling pathways through its intracytoplasmic YxxM motif. This receptor complex may have a role in cell survival and proliferation by activation of NK and T cell responses. Alternative splicing results in two transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus HCST Antibody is a mouse antibody against HCST. It can be used for HCST detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHematopoietic cell signal transducer; HCST
UniProt IDF7AQW3
Protein RefseqThe length of the protein is 92 amino acids long.
The sequence is show below: MIHPGHILFLLLLPVAAAQTTPGERSLLAFYPGTSGSCSGCGSLSLPLLAGLVAADAVASLLIVGVVFLCARPRRSPAQEDGKVYINMPGRG.
For Research Use Only | Not For Clinical Use.
Online Inquiry