Mouse Anti-HDAC1 Antibody (MO-AB-00605L)


Cat: MO-AB-00605L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00605L Monoclonal Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Malaria parasite, Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO00605L 100 µg
CBMOAB-44403FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO44403FYA 100 µg
CBMOAB-79186FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79186FYA 100 µg
MO-AB-08635W Monoclonal Cat (Felis catus) WB, ELISA MO08635W 100 µg
MO-AB-13248W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO13248W 100 µg
MO-AB-31098W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31098W 100 µg
MO-AB-34875W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34875W 100 µg
MO-AB-41800W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41800W 100 µg
MO-AB-56613W Monoclonal Marmoset WB, ELISA MO56613W 100 µg
MO-AB-13585R Monoclonal Cattle (Bos taurus) WB, ELISA MO13585R 100 µg
MO-AB-04192H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04192C 100 µg
MO-AB-12744H Monoclonal Malaria parasite WB, ELISA MO12744C 100 µg
MO-AB-08337Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08337Y 100 µg
MO-AB-15621Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15621Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityElephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Malaria parasite, Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO00605L
SpecificityThis antibody binds to Elephant HDAC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionResponsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. (From uniprot, under CC BY 4.0)
Product OverviewThis product is a mouse antibody against HDAC1. It can be used for HDAC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone Deacetylase 1; EC 3.5.1.98; RPD3L1; HD1; Reduced Potassium Dependency, Yeast Homolog-Like 1; GON-10; RPD3
UniProt IDG3SV40
Protein RefseqThe length of the protein is 482 amino acids long. The sequence is show below: MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFRPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHSKCVEFVRNFNLPMLMLGGGGYTIRNVARCWTYETAVALSTDIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA.
See other products for " HDAC1 "
For Research Use Only | Not For Clinical Use.
Online Inquiry