Mouse Anti-HDAC1 Antibody (MO-AB-00605L)
Cat: MO-AB-00605L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
MO-AB-00605L | Monoclonal | Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Malaria parasite, Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO00605L | 100 µg | ||
CBMOAB-44403FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO44403FYA | 100 µg | ||
CBMOAB-79186FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO79186FYA | 100 µg | ||
MO-AB-08635W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO08635W | 100 µg | ||
MO-AB-13248W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO13248W | 100 µg | ||
MO-AB-31098W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31098W | 100 µg | ||
MO-AB-34875W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34875W | 100 µg | ||
MO-AB-41800W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41800W | 100 µg | ||
MO-AB-56613W | Monoclonal | Marmoset | WB, ELISA | MO56613W | 100 µg | ||
MO-AB-13585R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13585R | 100 µg | ||
MO-AB-04192H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04192C | 100 µg | ||
MO-AB-12744H | Monoclonal | Malaria parasite | WB, ELISA | MO12744C | 100 µg | ||
MO-AB-08337Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08337Y | 100 µg | ||
MO-AB-15621Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15621Y | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Elephant (Loxodonta africana), Cat (Felis catus), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Malaria parasite, Marmoset, Rabbit (Oryctolagus cuniculus), Rhesus (Macaca mulatta), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO00605L |
Specificity | This antibody binds to Elephant HDAC1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. (From uniprot, under CC BY 4.0) |
Product Overview | This product is a mouse antibody against HDAC1. It can be used for HDAC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Histone Deacetylase 1; EC 3.5.1.98; RPD3L1; HD1; Reduced Potassium Dependency, Yeast Homolog-Like 1; GON-10; RPD3 |
UniProt ID | G3SV40 |
Protein Refseq | The length of the protein is 482 amino acids long. The sequence is show below: MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKANAEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSAGGSVASAVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAIFRPVISKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHSKCVEFVRNFNLPMLMLGGGGYTIRNVARCWTYETAVALSTDIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLEKIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEFSDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVKLA. |
See other products for " HDAC1 "
MO-AB-06549Y | Mouse Anti-HDAC1 Antibody (MO-AB-06549Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry