Mouse Anti-Hdac3 Antibody (CBMOAB-18410FYA)


Cat: CBMOAB-18410FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-18410FYA Monoclonal Fruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO18410FYA 100 µg
CBMOAB-79192FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79192FYA 100 µg
MO-AB-00645R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00645R 100 µg
MO-AB-02270Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02270Y 100 µg
MO-AB-07954W Monoclonal Cat (Felis catus) WB, ELISA MO07954W 100 µg
MO-AB-12508W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO12508W 100 µg
MO-AB-13593R Monoclonal Cattle (Bos taurus) WB, ELISA MO13593R 100 µg
MO-AB-15622Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15622Y 100 µg
MO-AB-26302R Monoclonal Pig (Sus scrofa) WB, ELISA MO26302R 100 µg
MO-AB-31101W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31101W 100 µg
MO-AB-33287H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33287C 100 µg
MO-AB-34877W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34877W 100 µg
MO-AB-41801W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41801W 100 µg
MO-AB-45019W Monoclonal Horse (Equus caballus) WB, ELISA MO45019W 100 µg
MO-AB-56618W Monoclonal Marmoset WB, ELISA MO56618W 100 µg
MO-DKB-00716W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta) WB, ChIP, IF, IHC, IHC-P, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO18410FYA
SpecificityThis antibody binds to fruit fly Hdac3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. (From NCBI)
Product OverviewMouse Anti-D. melanogaster Hdac3 Antibody is a mouse antibody against Hdac3. It can be used for Hdac3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone deacetylase; EC 3.5.1.98; Hdac3; HDAC3
UniProt IDQ9VNC2
Protein RefseqThe length of the protein is 438 amino acids long.
The sequence is show below: MTDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDMLRFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGAQKLNHNHSDICINWSGGLHHAKKFEASGFCYVDDIVIGILELLKYHPRVLYIDIDVHHGDGVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQVFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKELNVPTLVVGGGGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFAPDFTLHPEINSRQDNANSKQYLELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRSNREEASDPDVRISVADEDKLVDAKNEFYDGDQDQDKPDSAES.
For Research Use Only | Not For Clinical Use.
Online Inquiry