Mouse Anti-Hdac3 Antibody (CBMOAB-18410FYA)
Cat: CBMOAB-18410FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-18410FYA | Monoclonal | Fruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO18410FYA | 100 µg | ||
CBMOAB-79192FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO79192FYA | 100 µg | ||
MO-AB-00645R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00645R | 100 µg | ||
MO-AB-02270Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02270Y | 100 µg | ||
MO-AB-07954W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07954W | 100 µg | ||
MO-AB-12508W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12508W | 100 µg | ||
MO-AB-13593R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13593R | 100 µg | ||
MO-AB-15622Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15622Y | 100 µg | ||
MO-AB-26302R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26302R | 100 µg | ||
MO-AB-31101W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31101W | 100 µg | ||
MO-AB-33287H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33287C | 100 µg | ||
MO-AB-34877W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34877W | 100 µg | ||
MO-AB-41801W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41801W | 100 µg | ||
MO-AB-45019W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45019W | 100 µg | ||
MO-AB-56618W | Monoclonal | Marmoset | WB, ELISA | MO56618W | 100 µg | ||
MO-DKB-00716W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta) | WB, ChIP, IF, IHC, IHC-P, IP | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Fruit fly (Drosophila melanogaster), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Guinea pig (Cavia porcellus), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Rhesus (Macaca mulatta), Marmoset, Medaka (Oryzias latipes), Nile tilapia (Oreochromis niloticus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO18410FYA |
Specificity | This antibody binds to fruit fly Hdac3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene belongs to the histone deacetylase/acuc/apha family. It has histone deacetylase activity and represses transcription when tethered to a promoter. It may participate in the regulation of transcription through its binding with the zinc-finger transcription factor YY1. This protein can also down-regulate p53 function and thus modulate cell growth and apoptosis. This gene is regarded as a potential tumor suppressor gene. |
Product Overview | Mouse Anti-D. melanogaster Hdac3 Antibody is a mouse antibody against Hdac3. It can be used for Hdac3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Histone deacetylase; EC 3.5.1.98; Hdac3; HDAC3 |
UniProt ID | Q9VNC2 |
Protein Refseq | The length of the protein is 438 amino acids long. The sequence is show below: MTDRRVSYFYNADVGNFHYGAGHPMKPQRLAVTHSLVMNYGLHKKMKIYRPYKASAQDMLRFHSDEYIAYLQQVTPQNIQCNSVAYTKYLAHFSVGEDCPVFDGLFDFCAMYTGASLEGAQKLNHNHSDICINWSGGLHHAKKFEASGFCYVDDIVIGILELLKYHPRVLYIDIDVHHGDGVQEAFYLTDRVMTASFHKYGNYFFPGTGDMYEIGAESGRYYSVNVPLKEGIDDQSYFQVFKPIISAIMDFYRPTAIVLQCGADSLAGDRLGCFSLSTKGHGECVKFVKELNVPTLVVGGGGYTLRNVARCWTHETSLLVDQDIENDLPATEYYDFFAPDFTLHPEINSRQDNANSKQYLELIVKHVYENLKMCQHSPSVQMVQTPPDVDLEELRSNREEASDPDVRISVADEDKLVDAKNEFYDGDQDQDKPDSAES. |
For Research Use Only | Not For Clinical Use.
Online Inquiry