Mouse Anti-HGD Antibody (CBMOAB-44517FYA)


Cat: CBMOAB-44517FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44517FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Zebrafish, Zebrafish (Danio rerio) WB, ELISA MO44517FYA 100 µg
CBMOAB-79403FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79403FYA 100 µg
MO-AB-04218H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04218C 100 µg
MO-AB-13647R Monoclonal Cattle (Bos taurus) WB, ELISA MO13647R 100 µg
MOFAB-518W Monoclonal Zebrafish WB, IHC, IP 100 µg
MOFY-1222-FY27 Polyclonal Zebrafish WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Zebrafish, Zebrafish (Danio rerio)
CloneMO44517FYA
SpecificityThis antibody binds to Rhesus HGD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the enzyme homogentisate 1,2 dioxygenase. This enzyme is involved in the catabolism of the amino acids tyrosine and phenylalanine. Mutations in this gene are the cause of the autosomal recessive metabolism disorder alkaptonuria.
Product OverviewMouse Anti-Rhesus HGD Antibody is a mouse antibody against HGD. It can be used for HGD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomogentisate 1,2-dioxygenase; HGD
UniProt IDH9Z8A0
Protein RefseqThe length of the protein is 445 amino acids long.
The sequence is show below: MGEMLYISGFGNECASEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNKRSWLYRILPSVSHKPFESIDEGHVTHNWDEVDPDPNQLRWKPFEIPKASQKKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIVPQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYLLEVYGVHFELPDLGPIGANGLANPRDFLIPVAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPYKYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKAKLAPERIADGTMAFMFESSLSLAVTKWGLKASKCLDENYYKCWEPLKSHFTPNSRNPAEPN.
For Research Use Only | Not For Clinical Use.
Online Inquiry