Mouse Anti-Hhex Antibody (CBMOAB-20505FYA)


Cat: CBMOAB-20505FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-20505FYA Monoclonal Fruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO20505FYA 100 µg
CBMOAB-44523FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO44523FYA 100 µg
CBMOAB-79422FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79422FYA 100 µg
MO-AB-11623Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO11623Y 100 µg
MO-AB-13653R Monoclonal Cattle (Bos taurus) WB, ELISA MO13653R 100 µg
MO-AB-22418W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22418W 100 µg
MO-AB-56714W Monoclonal Marmoset WB, ELISA MO56714W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, O. mykiss (Oncorhynchus mykiss), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO20505FYA
SpecificityThis antibody binds to fruit fly Hhex.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation.
Product OverviewMouse Anti-D. melanogaster Hhex Antibody is a mouse antibody against Hhex. It can be used for Hhex detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCG7056; HHEX
UniProt IDQ9VDF0
Protein RefseqThe length of the protein is 323 amino acids long.
The sequence is show below: MDIATKSSKAAFSIENILEQKSSSHRSQSRRGSSQSPVAVTAGIATPHALAMPKASLATGSSSAAPTPSPSSATNIYDLSREAAAAQYAMKSMDSSAVLAPTSLRFNPIYPDPASLFYQQVLQLQKNPSLFMPHFQAAAVAAAAAVQPTAYCDQYSPFTMDCEGFPNPASAAAALYCNAYPAASFYMSNFGVKRKGGQIRFTSQQTKNLEARFASSKYLSPEERRHLALQLKLTDRQVKTWFQNRRAKWRRANLSKRSASAQGPIAGAAVGSPSSASSSSVPVLNLGSGSRCGQQSDEEDRMYLSEDDEDDDEDEGEADETPK.
For Research Use Only | Not For Clinical Use.
Online Inquiry