AibGenesis™ Mouse Anti-HIC1 Antibody (CBMOAB-44533FYA)


Cat: CBMOAB-44533FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44533FYA Monoclonal Rhesus (Macaca mulatta), African clawed frog, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO44533FYA 100 µg
CBMOAB-79442FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79442FYA 100 µg
MO-AB-26284H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26284C 100 µg
MOFY-1222-FY241 Polyclonal African clawed frog WB, IHC, ICC, IF, ELISA 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), African clawed frog, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO44533FYA
SpecificityThis antibody binds to Rhesus HIC1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene functions as a growth regulatory and tumor repressor gene. Hypermethylation or deletion of the region of this gene have been associated with tumors and the contiguous-gene syndrome, Miller-Dieker syndrome. Alternative splicing of this gene results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus HIC1 Antibody is a mouse antibody against HIC1. It can be used for HIC1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHIC1
UniProt IDF7DKV5
Protein RefseqThe length of the protein is 608 amino acids long.
The sequence is show below: MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVIIVVQNALFRAHKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDFIYTGRLAXPPSAAEPPSGPEAGVNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPPGSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERGSPSERCEERGGDAAIYPGSLDGPGAGGDGDDYKSSSEETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSEQLNAHVEAHVEEEEALYGRAEAAEVAAGAAGLGPPFGGGGDKVAGTPGGLGELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTICGKKFTQRGTMTRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKFAQQRNLISHMKMHADGKGKLDFPEGVFAVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAELGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT.
For Research Use Only | Not For Clinical Use.
Online Inquiry