Mouse Anti-HIF3A Antibody (CBMOAB-44539FYA)


Cat: CBMOAB-44539FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44539FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Horse (Equus caballus) WB, ELISA MO44539FYA 100 µg
MO-AB-13663R Monoclonal Cattle (Bos taurus) WB, ELISA MO13663R 100 µg
MO-AB-45029W Monoclonal Horse (Equus caballus) WB, ELISA MO45029W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Horse (Equus caballus)
CloneMO44539FYA
SpecificityThis antibody binds to Rhesus HIF3A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the alpha-3 subunit of one of several alpha/beta-subunit heterodimeric transcription factors that regulate many adaptive responses to low oxygen tension (hypoxia). The alpha-3 subunit lacks the transactivation domain found in factors containing either the alpha-1 or alpha-2 subunits. It is thought that factors containing the alpha-3 subunit are negative regulators of hypoxia-inducible gene expression. Multiple alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Rhesus HIF3A Antibody is a mouse antibody against HIF3A. It can be used for HIF3A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHIF3A
UniProt IDF6XI56
Protein RefseqThe length of the protein is 630 amino acids long.
The sequence is show below: MRLTISYLRMHRLCTAGEWNQVGAGGEPLDACYLKALEGFVMVLTTEGDMAYLSENVSKHLGLSQLELIGHSIFDFIHPCDQEELQDALTPQQNLSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVLHCSGHMRAYKPPAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDMKFTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAVTGQYRFLARNGGYLWTQTQATVVSGGRGPQSESIVCVHFLISRVEETGVVLSLEQTEQHSRRPIQRGAPSQKDTPNPGNSLDAPGSRILAFLHPPSLSEAALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPRSPLSADLPDELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALDLEMLAPYISMDDDFQLNASEQLPRAYHRPLGAVPRPRAQSFHGLSPPALEPSLLPRWGSDPRLSCSNPSRGNPSASSSMAGARKRTLAQSAEDEDEGVELLGVRPPKRSPSPEPENFLLFPLSLSFLLTGGPAPGRLQDPSTHLLDLNEPLVLSLPILDPYPLGCAAPGLHASPFSLPTISVPQNCLHFPPQPSRHALTL.
For Research Use Only | Not For Clinical Use.
Online Inquiry