Mouse Anti-His2Av Antibody (CBMOAB-20540FYA)


Cat: CBMOAB-20540FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-20540FYA Monoclonal Fruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster) WB, ELISA MO20540FYA 100 µg
MO-NAB-00869W Monoclonal D. melanogaster (Drosophila melanogaster) ELISA, IF, WB NW0791 100 µg
MO-DKB-00513W Polyclonal Fruit fly (Drosophila melanogaster) WB, ELISA, IF, IHC 100 µg
MO-DKB-03707W Polyclonal D. melanogaster (Drosophila melanogaster) ELISA, WB, IHC 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), D. melanogaster (Drosophila melanogaster)
CloneMO20540FYA
SpecificityThis antibody binds to fruit fly His2Av.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionVariant histone H2A which replaces conventional H2A in a subset of nucleosomes. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. Acts as a Polycomb group (PcG) protein required to maintain the transcriptionally repressive state of homeotic genes of the animal throughout development. Required for histone H3 'Lys-9' methylation and histone H4 'Lys-12' acetylation, two modifications that are essential for heterochromatin formation. Also involved in DNA double strand break (DSB) repair. Essential for early development. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-D. melanogaster His2Av Antibody is a mouse antibody against His2Av. It can be used for His2Av detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2A.v; H2A.F/Z; H2A.Z; His2Av; H2AvD His2AvD
UniProt IDP08985
Protein RefseqThe length of the protein is 141 amino acids long.
The sequence is show below: MAGGKAGKDSGKAKAKAVSRSARAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKEETVQDPQRKGNVILSQAY.
For Research Use Only | Not For Clinical Use.
Online Inquiry