AibGenesis™ Mouse Anti-HIST3H2A Antibody (MO-AB-09081W)


Cat: MO-AB-09081W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-09081W Monoclonal Cat (Felis catus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Sheep (Ovis aries) WB, ELISA MO09081W 100 µg
MO-AB-15646Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15646Y 100 µg
MO-AB-23831W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO23831W 100 µg
MO-AB-34893W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34893W 100 µg
MO-AB-56782W Monoclonal Marmoset WB, ELISA MO56782W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus), Chimpanzee (Pan troglodytes), Ferret (Mustela Putorius Furo), Marmoset, Sheep (Ovis aries)
CloneMO09081W
SpecificityThis antibody binds to Cat HIST3H2A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. (From NCBI)
Product OverviewMouse Anti-Cat HIST3H2A Antibody is a mouse antibody against HIST3H2A. It can be used for HIST3H2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHistone H2A; HIST3H2A
UniProt IDM3XAE0
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKKTESHHKAKGK.
For Research Use Only | Not For Clinical Use.
Online Inquiry