Mouse Anti-HMGB2 Antibody (CBMOAB-34643FYC)


Cat: CBMOAB-34643FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-34643FYC Monoclonal A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) WB, ELISA MO34643FC 100 µg
CBMOAB-44647FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO44647FYA 100 µg
MO-AB-02296Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02296Y 100 µg
MO-AB-04277H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04277C 100 µg
MO-AB-13701R Monoclonal Cattle (Bos taurus) WB, ELISA MO13701R 100 µg
MO-AB-17804W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17804W 100 µg
MO-AB-26318H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO26318C 100 µg
MO-AB-26344R Monoclonal Pig (Sus scrofa) WB, ELISA MO26344R 100 µg
MO-AB-56820W Monoclonal Marmoset WB, ELISA MO56820W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta)
CloneMO34643FC
SpecificityThis antibody binds to Arabidopsis HMGB2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. (From NCBI)
Product OverviewMouse Anti-Arabidopsis HMGB2 Antibody is a mouse antibody against HMGB2. It can be used for HMGB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHigh Mobility Group Box 2; High-Mobility Group (Nonhistone Chromosomal) Protein 2; High Mobility Group Protein 2; HMG-2; HMG2; High Mobility Group Protein B2; High-Mobility Group Box 2
UniProt IDO49596
Protein RefseqThe length of the protein is 144 amino acids long. The sequence is show below: MKGAKSKTETRSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKKLEEGPKEDEESDKSVSEVNDEDDAEDGSEEEEDDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry