Mouse Anti-HMGB2 Antibody (CBMOAB-34643FYC)
Cat: CBMOAB-34643FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-34643FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) | WB, ELISA | MO34643FC | 100 µg | ||
CBMOAB-44647FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO44647FYA | 100 µg | ||
MO-AB-02296Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02296Y | 100 µg | ||
MO-AB-04277H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04277C | 100 µg | ||
MO-AB-13701R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13701R | 100 µg | ||
MO-AB-17804W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO17804W | 100 µg | ||
MO-AB-26318H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26318C | 100 µg | ||
MO-AB-26344R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26344R | 100 µg | ||
MO-AB-56820W | Monoclonal | Marmoset | WB, ELISA | MO56820W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Pig (Sus scrofa), Rat (Rattus norvegicus), Rhesus (Macaca mulatta) |
Clone | MO34643FC |
Specificity | This antibody binds to Arabidopsis HMGB2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the non-histone chromosomal high mobility group protein family. The proteins of this family are chromatin-associated and ubiquitously distributed in the nucleus of higher eukaryotic cells. In vitro studies have demonstrated that this protein is able to efficiently bend DNA and form DNA circles. These studies suggest a role in facilitating cooperative interactions between cis-acting proteins by promoting DNA flexibility. This protein was also reported to be involved in the final ligation step in DNA end-joining processes of DNA double-strand breaks repair and V(D)J recombination. (From NCBI) |
Product Overview | Mouse Anti-Arabidopsis HMGB2 Antibody is a mouse antibody against HMGB2. It can be used for HMGB2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | High Mobility Group Box 2; High-Mobility Group (Nonhistone Chromosomal) Protein 2; High Mobility Group Protein 2; HMG-2; HMG2; High Mobility Group Protein B2; High-Mobility Group Box 2 |
UniProt ID | O49596 |
Protein Refseq | The length of the protein is 144 amino acids long. The sequence is show below: MKGAKSKTETRSSKLSVTKKPAKGAGRGKAAAKDPNKPKRPASAFFVFMEDFRETFKKENPKNKSVATVGKAAGDKWKSLSDSEKAPYVAKAEKRKVEYEKNIKAYNKKLEEGPKEDEESDKSVSEVNDEDDAEDGSEEEEDDD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry