Mouse Anti-HMGB3 Antibody (CBMOAB-34644FYC)
Cat: CBMOAB-34644FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-34644FYC | Monoclonal | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Horse (Equus caballus), Mammal, Dog (Canis lupus familiaris), Primat, Rhesus (Macaca mulatta) | WB, ELISA | MO34644FC | 100 µg | ||
| MO-AB-04279H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04279C | 100 µg | ||
| MO-AB-12423W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO12423W | 100 µg | ||
| MO-AB-13702R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13702R | 100 µg | ||
| MO-AB-26319H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO26319C | 100 µg | ||
| MO-DKB-01174W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Horse (Equus caballus), Mammal, Dog (Canis lupus familiaris), Primat, Rhesus (Macaca mulatta) | WB | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Bovine (Bos taurus), Horse (Equus caballus), Mammal, Dog (Canis lupus familiaris), Primat, Rhesus (Macaca mulatta) |
| Clone | MO34644FC |
| Specificity | This antibody binds to Arabidopsis HMGB3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of a family of proteins containing one or more high mobility group DNA-binding motifs. The encoded protein plays an important role in maintaining stem cell populations, and may be aberrantly expressed in tumor cells. A mutation in this gene was associated with microphthalmia, syndromic 13. There are numerous pseudogenes of this gene on multiple chromosomes. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Arabidopsis HMGB3 Antibody is a mouse antibody against HMGB3. It can be used for HMGB3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | High Mobility Group Box 3; High-Mobility Group (Nonhistone Chromosomal) Protein 4; High Mobility Group Protein 2a; HMG-2a; HMG-4; HMG2A |
| UniProt ID | P93047 |
| Protein Refseq | The length of the protein is 141 amino acids long. The sequence is show below: MKGAKSKAETRSTKLSVTKKPAKGAKGAAKDPNKPKRPSSAFFVFMEDFRVTYKEEHPKNKSVAAVGKAGGEKWKSLSDSEKAPYVAKADKRKVEYEKNMKAYNKKLEEGPKEDEESDKSVSEVNDEDDAEDGSEEEEDDD. |
For Research Use Only | Not For Clinical Use.
Online Inquiry