Mouse Anti-HMOX1 Antibody (CBMOAB-44675FYA)
Cat: CBMOAB-44675FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-44675FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea Pig (Cavia porcellus), Hamster (Cricetulus griseus), Human (Homo sapiens), Monkey, Mouse (Mus musculus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Mallard (Anas platyrhynchos), Marmoset | WB, ELISA | MO44675FYA | 100 µg | ||
MO-AB-02305Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02305Y | 100 µg | ||
MO-AB-04292H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04292C | 100 µg | ||
MO-AB-13718R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13718R | 100 µg | ||
MO-AB-20336W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO20336W | 100 µg | ||
MO-AB-23284H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO23284C | 100 µg | ||
MO-AB-37421W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO37421W | 100 µg | ||
MO-AB-56843W | Monoclonal | Marmoset | WB, ELISA | MO56843W | 100 µg | ||
MO-NAB-00030W | Monoclonal | Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea Pig (Cavia porcellus), Hamster (Cricetulus griseus), Human (Homo sapiens), Monkey, Mouse (Mus musculus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) | WB, IHC, IF, IP, ELISA | NW0153 | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea Pig (Cavia porcellus), Hamster (Cricetulus griseus), Human (Homo sapiens), Monkey, Mouse (Mus musculus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Mallard (Anas platyrhynchos), Marmoset |
Clone | MO44675FYA |
Specificity | This antibody binds to Rhesus HMOX1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. |
Product Overview | Mouse Anti-Rhesus HMOX1 Antibody is a mouse antibody against HMOX1. It can be used for HMOX1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | HMOX1 |
UniProt ID | F6QK66 |
Protein Refseq | The length of the protein is 288 amino acids long. The sequence is show below: MERLQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTREGFKLVMASLHHIYVALEEEIERNKESPVFAPVYFPEELHRKATLEQDLAFWYGPRWQEVIPYTLAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQMLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPSVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSQAPGLRQRASNKAQDSAPVETPRGKPQLNTRSQAPLLRWILMFSFLVATVAVGLYAM. |
For Research Use Only | Not For Clinical Use.
Online Inquiry