AibGenesis™ Mouse Anti-HNRNPAB Antibody (CBMOAB-44695FYA)
Cat: CBMOAB-44695FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-44695FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Marmoset | WB, ELISA | MO44695FYA | 100 µg | ||
| MO-AB-04303H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04303C | 100 µg | ||
| MO-AB-13727R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13727R | 100 µg | ||
| MO-AB-23482W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO23482W | 100 µg | ||
| MO-AB-56856W | Monoclonal | Marmoset | WB, ELISA | MO56856W | 100 µg | ||
| MO-DKB-01193W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Rhesus (Macaca mulatta) | WB, ChIP, IF, IHC, IHC-P, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Bovine (Bos taurus), Chicken (Gallus gallus), Marmoset |
| Clone | MO44695FYA |
| Specificity | This antibody binds to Rhesus HNRNPAB. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are produced by RNA polymerase II and are components of the heterogeneous nuclear RNA (hnRNA) complexes. They are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene, which binds to one of the components of the multiprotein editosome complex, has two repeats of quasi-RRM (RNA recognition motif) domains that bind to RNAs. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus HNRNPAB Antibody is a mouse antibody against HNRNPAB. It can be used for HNRNPAB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | HNRNPAB |
| UniProt ID | F6XXZ7 |
| Protein Refseq | The length of the protein is 327 amino acids long. The sequence is show below: MSEAGEEQPMETTGATENGHEAAPEGEGRGWHGRHGLEARPRRPRAGIRTAPDQINASKNEEDAGKMFVGGLSWDTSKKDLKDYFTKFGEVVDCTIKMDPNTGRSRGFGFILFKDAASVEKVLDQKEHRLDGRVIDPKKAMAMKKDPVKKIFVGGLNPEATEEKIREYFGEFGEIEAIELPMDPKLNKRRGFVFITFKEEEPVKKVLEKKFHTISGSKCEIKVAQPKEVYQQQQYGSGGRGNRNRGNRGSGGGGGGGGQSQSWNQGYGNYWNQGYGYQQGYGPGYGGYDYSPYGYYGYGPGYDYSQGSTNYGKSQRRGGHQNNYKPY. |
For Research Use Only | Not For Clinical Use.
Online Inquiry