Mouse Anti-Horse aqp5 Antibody (MO-AB-43703W)
Cat: MO-AB-43703W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO43703W |
Specificity | This antibody binds to Horse aqp5. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Plasma membrane; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Aquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13. |
Product Overview | Mouse Anti-Horse aqp5 Antibody is a mouse antibody against aqp5. It can be used for aqp5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Aquaporin 5; Aquaporin-2; aqp5; AQP2 |
UniProt ID | Q70WU4 |
Protein Refseq | The length of the protein is82 amino acids long. The sequence is show below: MNPARSFGPAVIMKRFSSAHWVFWVGPIVGAALAAILYFYLLFPNSLSLSERVAIVKGTYEPEEDWEEQREERKKTMELTAH. |
See other products for " AQP5 "
MO-AB-00164Y | Mouse Anti-Chicken AQP5 Antibody (MO-AB-00164Y) |
CBMOAB-00595HCB | Mouse Anti-C. elegans AQP5 Antibody (CBMOAB-00595HCB) |
MO-AB-14226Y | Mouse Anti-Sheep AQP5 Antibody (MO-AB-14226Y) |
MO-AB-22964H | Mouse Anti-Mallard aqp5 Antibody (MO-AB-22964H) |
CBMOAB-36101FYA | Mouse Anti-Rhesus AQP5 Antibody (CBMOAB-36101FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry