Mouse Anti-Horse aqp5 Antibody (MO-AB-43703W)


Cat: MO-AB-43703W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43703W
SpecificityThis antibody binds to Horse aqp5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAquaporin 5 (AQP5) is a water channel protein. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). Aquaporin 5 plays a role in the generation of saliva, tears and pulmonary secretions. AQP0, AQP2, AQP5, and AQP6 are closely related and all map to 12q13.
Product OverviewMouse Anti-Horse aqp5 Antibody is a mouse antibody against aqp5. It can be used for aqp5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAquaporin 5; Aquaporin-2; aqp5; AQP2
UniProt IDQ70WU4
Protein RefseqThe length of the protein is82 amino acids long.
The sequence is show below: MNPARSFGPAVIMKRFSSAHWVFWVGPIVGAALAAILYFYLLFPNSLSLSERVAIVKGTYEPEEDWEEQREERKKTMELTAH.
For Research Use Only | Not For Clinical Use.
Online Inquiry