Mouse Anti-Horse CCR5 Antibody (MO-AB-43952W)


Cat: MO-AB-43952W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO43952W
SpecificityThis antibody binds to Horse CCR5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCCR5 (C-C Motif Chemokine Receptor 5 (Gene/Pseudogene)) is a Protein Coding gene. Diseases associated with CCR5 include West Nile Virus and Diabetes Mellitus, Insulin-Dependent, 22. Among its related pathways are Cytokine Signaling in Immune system and Akt Signaling. Gene Ontology (GO) annotations related to this gene include G-protein coupled receptor activity and phosphatidylinositol phospholipase C activity. An important paralog of this gene is CCR2.
Product OverviewMouse Anti-Horse CCR5 Antibody is a mouse antibody against CCR5. It can be used for CCR5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCC chemokine receptor type 5; Chemokine receptor 5; CCR5
UniProt IDA4ZZ54
Protein RefseqThe length of the protein is352 amino acids long.
The sequence is show below: MDYQTTSPFYDIDYGMSEPCQKTDVRQIAARLLPPLYSLVFISGFVGNLLVALVLIKCKKLKSMTDIYLLNLAISDLLFLLTLPFWAHYAAHQWELGNTMCRLLTGLYFIGFFSGIFFIILLTIDRYLAIVHAVFALKARTVTFGLMTSGVTWAVAVFVSLPGIIFTKSQKEGTRFTCSPHYPPSQYHFWRNFQALKMTILGLVLPLLVMIICYSGILKTLLRCRNEKKRHKAVRLIFVIMIMYFLFWAPYNIVLLLSTFQKSFGLDQCSSSNRLDQAMQVTETLGMTHCCINPVIYAFVGEKFRNYLLGYFRKHIVRRFCKSCPVFQGEAPKRVNSIYTGSTGEQEISVGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry