Mouse Anti-Horse clc Antibody (MO-AB-44055W)


Cat: MO-AB-44055W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44055W
SpecificityThis antibody binds to Horse clc.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionLysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene is a lysophospholipase expressed in eosinophils and basophils. It hydrolyzes lysophosphatidylcholine to glycerophosphocholine and a free fatty acid. This protein may possess carbohydrate or IgE-binding activities. It is both structurally and functionally related to the galectin family of beta-galactoside binding proteins. It may be associated with inflammation and some myeloid leukemias.
Product OverviewMouse Anti-Horse clc Antibody is a mouse antibody against clc. It can be used for clc detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesClathrin light chain; clc
UniProt IDC0SW05
Protein RefseqThe length of the protein is213 amino acids long.
The sequence is show below: MAELDPFGVPAGGPALGNGVAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAPGSQPHGEPPGIPDAVDGVTNGDYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTERLEALDANSRKQEAEWKEKAIKELDEWYARQDEQLQKTKANNRAAEEAFVNDIEESSPGTEWERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH.
For Research Use Only | Not For Clinical Use.
Online Inquiry