Mouse Anti-Horse CUL4B Antibody (MO-AB-44227W)


Cat: MO-AB-44227W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44227W
SpecificityThis antibody binds to Horse CUL4B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCUL4B (Cullin 4B) is a Protein Coding gene. Diseases associated with CUL4B include Mental Retardation, X-Linked, Syndromic, Cabezas Type and Seizure Disorder. Among its related pathways are Mesodermal Commitment Pathway and Transcription-Coupled Nucleotide Excision Repair (TC-NER). Gene Ontology (GO) annotations related to this gene include ubiquitin protein ligase binding and damaged DNA binding. An important paralog of this gene is CUL4A.
Product OverviewMouse Anti-Horse CUL4B Antibody is a mouse antibody against CUL4B. It can be used for CUL4B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCullin 4B; CUL4B
UniProt IDQ8MJ96
Protein RefseqThe length of the protein is146 amino acids long.
The sequence is show below: TSLDQTTQKSLIATEEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGSAIVINPEKDKTMVQELLYFKDKVDHIIDICCLKNEKFITAMNEAFETFINRRPNEPAELMAKYGDSKLRTGH.
For Research Use Only | Not For Clinical Use.
Online Inquiry