Mouse Anti-Horse GFAP Antibody (MO-AB-44854W)


Cat: MO-AB-44854W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44854W
SpecificityThis antibody binds to Horse GFAP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product OverviewMouse Anti-Horse GFAP Antibody is a mouse antibody against GFAP. It can be used for GFAP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesGlial fibrillary acidic protein; GFAP
UniProt IDQ864W8
Protein RefseqThe length of the protein is118 amino acids long.
The sequence is show below: DETNLRLEAENNLAAYRQEADEATLARVDLERKIESLEEEIRFLRKIHEEEVRELQEQLAQQQVHVELDVAKPDLTAALREIRTQYEAMASSNMHEAEEWYRSKFADLTDAAARNAEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry