Mouse Anti-Horse IL6 Antibody (MO-AB-45156W)
Cat: MO-AB-45156W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO45156W |
Specificity | This antibody binds to Horse IL6. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Horse IL6 Antibody is a mouse antibody against IL6. It can be used for IL6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Interleukin 6; IL6 |
UniProt ID | A4L7T6 |
Protein Refseq | The length of the protein is89 amino acids long. The sequence is show below: QIYLEYLQNEFKGEKENIKTMQISTKVLVQILMQKMRNPEVTTPDPTAKSSLLAKLHSQNEWLKNTTTHLILRSLEDFLQFSLRAVRIM. |
See other products for " IL6 "
MOFY-0722-FY245 | Rabbit Anti-IL6 Antibody (MOFY-0722-FY245) |
MOFY-0722-FY374 | Rabbit Anti-IL6 Antibody (MOFY-0722-FY374) |
MOFY-0622-FY99 | Rabbit Anti-IL6 Antibody (MOFY-0622-FY99) |
MOFY-0722-FY393 | Biotin conjugated antibody to IL6 Antibody (MOFY-0722-FY393) |
MOFY-0622-FY117 | Rabbit Anti-IL6 Antibody (MOFY-0622-FY117) |
MO-AB-02549Y | Mouse Anti-Chicken IL6 Antibody (MO-AB-02549Y) |
MOFY-0622-FY19 | Biotin conjugated Monoclonal antibody to IL6 (MOFY-0622-FY19) |
MOFY-0722-FY444 | Rabbit Anti-IL6 Antibody (MOFY-0722-FY444) |
MOFY-0722-FY439 | FITC conjugated antibody to IL6 Antibody (MOFY-0722-FY439) |
MO-AB-21157W | Mouse Anti-Chimpanzee IL6 Antibody (MO-AB-21157W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry