Mouse Anti-Horse inos Antibody (MO-AB-45174W)
Cat: MO-AB-45174W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO45174W |
Specificity | This antibody binds to Horse inos. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Product Overview | Mouse Anti-Horse inos Antibody is a mouse antibody against inos. It can be used for inos detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Inducible nitric oxide synthase; inos |
UniProt ID | Q8HY36 |
Protein Refseq | The length of the protein is66 amino acids long. The sequence is show below: PRSELPEGSILGFSQATSRLWSKVSWSEWWMALHPTNPCAWRPSTRAAATGSRTSGCPPAHSARHS. |
See other products for " iNOS "
MO-AB-14201R | Mouse Anti-Cattle iNOS Antibody (MO-AB-14201R) |
CBMOAB-21051FYA | Mouse Anti-D. melanogaster Inos Antibody (CBMOAB-21051FYA) |
MO-AB-57281W | Mouse Anti-Marmoset iNOS Antibody (MO-AB-57281W) |
MO-AB-11876Y | Mouse Anti-O. mykiss iNOS Antibody (MO-AB-11876Y) |
MO-AB-02569Y | Mouse Anti-Chicken INOS Antibody (MO-AB-02569Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry