Mouse Anti-Horse LBR Antibody (MO-AB-45331W)
Cat: MO-AB-45331W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO45331W |
Specificity | This antibody binds to Horse LBR. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Anchors the lamina and the heterochromatin to the inner nuclear membrane. |
Product Overview | Mouse Anti-Horse LBR Antibody is a mouse antibody against LBR. It can be used for LBR detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Lamin-b receptor-like protein; LBR |
UniProt ID | L7MS39 |
Protein Refseq | The length of the protein is86 amino acids long. The sequence is show below: TGKSLLVSGWWGFVRHPNYLGDLVMALAWSLPCGFNHILPYFYVIYFTLLLIHREARDEHQCRKKYGLAWEKYCRRVPYRIFPHIY. |
See other products for " lbr "
MO-AB-04796H | Mouse Anti-Frog lbr Antibody (MO-AB-04796H) |
CBMOAB-82474FYA | Mouse Anti-Zebrafish lbr Antibody (CBMOAB-82474FYA) |
MO-AB-58081W | Mouse Anti-Marmoset LBR Antibody (MO-AB-58081W) |
MO-AB-02708Y | Mouse Anti-Chicken LBR Antibody (MO-AB-02708Y) |
MO-AB-26950R | Mouse Anti-Pig LBR Antibody (MO-AB-26950R) |
CBMOAB-22705FYA | Mouse Anti-D. melanogaster Lbr Antibody (CBMOAB-22705FYA) |
MO-AB-14835R | Mouse Anti-Cattle LBR Antibody (MO-AB-14835R) |
MO-AB-21924W | Mouse Anti-Chimpanzee LBR Antibody (MO-AB-21924W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry