Mouse Anti-Horse MDH1 Antibody (MO-AB-45465W)
Cat: MO-AB-45465W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO45465W |
Specificity | This antibody binds to Horse MDH1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6. |
Product Overview | Mouse Anti-Horse MDH1 Antibody is a mouse antibody against MDH1. It can be used for MDH1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Malate dehydrogenase; EC 1.1.1.37; MDH1 |
UniProt ID | F7CZS6 |
Protein Refseq | The length of the protein is334 amino acids long. The sequence is show below: MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRRDGMERKDLLKANVKIFKCQGAALEKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTSDDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFITTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVVSDGNSYGVPDDLLYSFPVTVKDKTWKVVEGLPINDFSREKMDLTAKELAEEKETAFEFLSSA. |
See other products for " MDH1 "
MO-AB-23556W | Mouse Anti-Chimpanzee MDH1 Antibody (MO-AB-23556W) |
MO-AB-31733W | Mouse Anti-Dog MDH1 Antibody (MO-AB-31733W) |
CBMOAB-36324FYC | Mouse Anti-Arabidopsis MDH1 Antibody (CBMOAB-36324FYC) |
MO-AB-15484R | Mouse Anti-Cattle MDH1 Antibody (MO-AB-15484R) |
MO-AB-58885W | Mouse Anti-Marmoset MDH1 Antibody (MO-AB-58885W) |
MO-AB-16125Y | Mouse Anti-Sheep MDH1 Antibody (MO-AB-16125Y) |
MO-AB-08784Y | Mouse Anti-Rabbit MDH1 Antibody (MO-AB-08784Y) |
MO-AB-06631Y | Mouse Anti-O. anatinus MDH1 Antibody (MO-AB-06631Y) |
CBMOAB-23539FYA | Mouse Anti-D. melanogaster Mdh1 Antibody (CBMOAB-23539FYA) |
CBMOAB-02192CR | Mouse Anti-Yeast MDH1 Antibody (CBMOAB-02192CR) |
For Research Use Only | Not For Clinical Use.
Online Inquiry