Mouse Anti-Horse NCAM1 Antibody (MO-AB-45636W)


Cat: MO-AB-45636W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO45636W
SpecificityThis antibody binds to Horse NCAM1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a cell adhesion protein which is a member of the immunoglobulin superfamily. The encoded protein is involved in cell-to-cell interactions as well as cell-matrix interactions during development and differentiation. The encoded protein has been shown to be involved in development of the nervous system, and for cells involved in the expansion of T cells and dendritic cells which play an important role in immune surveillance. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Horse NCAM1 Antibody is a mouse antibody against NCAM1. It can be used for NCAM1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeural cell adhesion molecule 1; NCAM1
UniProt IDH6V7Y7
Protein RefseqThe length of the protein is106 amino acids long.
The sequence is show below: ISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMFKNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYL.
For Research Use Only | Not For Clinical Use.
Online Inquiry