Mouse Anti-Horse NF1 Antibody (MO-AB-45773W)


Cat: MO-AB-45773W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO45773W
SpecificityThis antibody binds to Horse NF1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene product appears to function as a negative regulator of the ras signal transduction pathway. Mutations in this gene have been linked to neurofibromatosis type 1, juvenile myelomonocytic leukemia and Watson syndrome. The mRNA for this gene is subject to RNA editing (CGA>UGA->Arg1306Term) resulting in premature translation termination. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene.
Product OverviewMouse Anti-Horse NF1 Antibody is a mouse antibody against NF1. It can be used for NF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesNeurofibromatosis type 1; NF1
UniProt IDQ8WMY8
Protein RefseqThe length of the protein is48 amino acids long.
The sequence is show below: VYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPMPTSHYFVWQWASVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry