Mouse Anti-Horse NF1 Antibody (MO-AB-45773W)
Cat: MO-AB-45773W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO45773W |
Specificity | This antibody binds to Horse NF1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene product appears to function as a negative regulator of the ras signal transduction pathway. Mutations in this gene have been linked to neurofibromatosis type 1, juvenile myelomonocytic leukemia and Watson syndrome. The mRNA for this gene is subject to RNA editing (CGA>UGA->Arg1306Term) resulting in premature translation termination. Alternatively spliced transcript variants encoding different isoforms have also been described for this gene. |
Product Overview | Mouse Anti-Horse NF1 Antibody is a mouse antibody against NF1. It can be used for NF1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Neurofibromatosis type 1; NF1 |
UniProt ID | Q8WMY8 |
Protein Refseq | The length of the protein is48 amino acids long. The sequence is show below: VYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPMPTSHYFVWQWASVA. |
See other products for " NF1 "
MO-AB-16678R | Mouse Anti-Cattle NF1 Antibody (MO-AB-16678R) |
MO-AB-10695W | Mouse Anti-Chimpanzee NF1 Antibody (MO-AB-10695W) |
MO-AB-32153W | Mouse Anti-Dog NF1 Antibody (MO-AB-32153W) |
MO-DKB-00448W | Rabbit Anti-NF1 Antibody (MO-DKB-00448W) |
CBMOAB-25601FYA | Mouse Anti-D. melanogaster Nf1 Antibody (CBMOAB-25601FYA) |
MO-AB-07453W | Mouse Anti-Cat NF1 Antibody (MO-AB-07453W) |
MO-AB-03116Y | Mouse Anti-Chicken NF1 Antibody (MO-AB-03116Y) |
MO-AB-16316Y | Mouse Anti-Sheep NF1 Antibody (MO-AB-16316Y) |
MO-AB-27728R | Mouse Anti-Pig NF1 Antibody (MO-AB-27728R) |
MO-AB-04675W | Mouse Anti-Rhesus NF1 Antibody (MO-AB-04675W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry