Mouse Anti-Horse OXT Antibody (MO-AB-45954W)
Cat: MO-AB-45954W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO45954W |
Specificity | This antibody binds to Horse OXT. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Extracellular region or secreted; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions. |
Product Overview | Mouse Anti-Horse OXT Antibody is a mouse antibody against OXT. It can be used for OXT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Oxytocin-neurophysin 1; OT-NPI; [Cleaved into: Oxytocin (Ocytocin); Neurophysin 1]; OXT |
UniProt ID | P01176 |
Protein Refseq | The length of the protein is105 amino acids long. The sequence is show below: CYIQNCPLGGKRAALDLDVRKCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQSGQKPCGSGGRCAAAGICCSPDGCLADPSCHDEAAFSQ. |
See other products for " oxt "
CBMOAB-91161FYA | Mouse Anti-Zebrafish oxt Antibody (CBMOAB-91161FYA) |
MO-AB-17004Y | Mouse Anti-Sheep OXT Antibody (MO-AB-17004Y) |
MO-AB-09268Y | Mouse Anti-Rabbit OXT Antibody (MO-AB-09268Y) |
MO-AB-27694H | Mouse Anti-Rat Oxt Antibody (MO-AB-27694H) |
MO-AB-17417R | Mouse Anti-Cattle OXT Antibody (MO-AB-17417R) |
MO-AB-60840W | Mouse Anti-Marmoset OXT Antibody (MO-AB-60840W) |
CBMOAB-53691FYA | Mouse Anti-Rhesus OXT Antibody (CBMOAB-53691FYA) |
CBMOAB-27076FYA | Mouse Anti-D. melanogaster Oxt Antibody (CBMOAB-27076FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry