Mouse Anti-Horse PER2 Antibody (MO-AB-46006W)
Cat: MO-AB-46006W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Horse (Equus caballus) |
| Clone | MO46006W |
| Specificity | This antibody binds to Horse PER2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers and have been linked to sleep disorders. |
| Product Overview | Mouse Anti-Horse PER2 Antibody is a mouse antibody against PER2. It can be used for PER2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Period 2; PER2 |
| UniProt ID | A0MNQ8 |
| Protein Refseq | The length of the protein is61 amino acids long. The sequence is show below: SSDTSHTSKYFGSIDSSENNHKAKAKVDVDGSEHFIKYVLQDPVWLLMADTDDSVMMTYQM. |
See other products for " PER2 "
| MO-AB-61303W | Mouse Anti-Marmoset PER2 Antibody (MO-AB-61303W) |
| CBMOAB-38551FYC | Mouse Anti-Arabidopsis PER2 Antibody (CBMOAB-38551FYC) |
| MO-AB-23588H | Mouse Anti-Mallard Per2 Antibody (MO-AB-23588H) |
| CBMOAB-92214FYA | Mouse Anti-Zebrafish per2 Antibody (CBMOAB-92214FYA) |
| MO-AB-03393Y | Mouse Anti-Chicken PER2 Antibody (MO-AB-03393Y) |
| MO-AB-20833W | Mouse Anti-Chimpanzee PER2 Antibody (MO-AB-20833W) |
| CBMOAB-54279FYA | Mouse Anti-Rhesus PER2 Antibody (CBMOAB-54279FYA) |
| MO-AB-17050Y | Mouse Anti-Sheep Per2 Antibody (MO-AB-17050Y) |
| MOFAB-574W | Mouse Anti-Zebrafish Per2 Antibody (MOFAB-574W) |
| MO-AB-06179H | Mouse Anti-Frog per2 Antibody (MO-AB-06179H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry