Mouse Anti-Horse PRL Antibody (MO-AB-46195W)


Cat: MO-AB-46195W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO46195W
SpecificityThis antibody binds to Horse PRL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProlactin is a hormone released by the pituitary gland. The pituitary is a small gland at the base of the brain. It regulates the body''s balance of many hormones. Prolactin stimulates breast development and milk production in women. There is no known normal function for prolactin in men.
Product OverviewMouse Anti-Horse PRL Antibody is a mouse antibody against PRL. It can be used for PRL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProlactin; PRL; PRL
UniProt IDP12420
Protein RefseqThe length of the protein is229 amino acids long.
The sequence is show below: MDKKRSSLKGSLLLLLLLVSDLLLCKSVASLPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC.
See other products for " prl "
MO-AB-03582YMouse Anti-Chicken prl Antibody (MO-AB-03582Y)
MOFAB-125WMouse Anti-PRL Antibody (MOFAB-125W)
MO-AB-01192LMouse Anti-Elephant PRL Antibody (MO-AB-01192L)
MO-AB-01372RMouse Anti-Medaka prl Antibody (MO-AB-01372R)
MOFY-0722-FY343Rabbit Anti-PRL Antibody (MOFY-0722-FY343)
MO-AB-32899WMouse Anti-Dog PRL Antibody (MO-AB-32899W)
MO-AB-17239YMouse Anti-Sheep PRL Antibody (MO-AB-17239Y)
MO-AB-08208WMouse Anti-Cat PRL Antibody (MO-AB-08208W)
MO-AB-23645HMouse Anti-Mallard PRL Antibody (MO-AB-23645H)
CBMOAB-93990FYAMouse Anti-Zebrafish prl Antibody (CBMOAB-93990FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry