Mouse Anti-Horse RPL6 Antibody (MO-AB-46370W)


Cat: MO-AB-46370W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO46370W
SpecificityThis antibody binds to Horse RPL6.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein component of the 60S ribosomal subunit. This protein can bind specifically to domain C of the tax-responsive enhancer element of human T-cell leukemia virus type 1, and may participate in tax-mediated transactivation of transcription. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed throughout the genome. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Horse RPL6 Antibody is a mouse antibody against RPL6. It can be used for RPL6 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names60S ribosomal protein L6; RPL6
UniProt IDF6QF58
Protein RefseqThe length of the protein is263 amino acids long.
The sequence is show below: KAKKANVKAKTPKKGKPHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYSAAKSRIERKKKEKVLATVTKPVGGDKNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTGRHRGKRVVFLKQLGSGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDISGVKIPKHLTDAYFKKKQLRKPRHQEGEIFDTEKEKYEVTEQRKVDQKAVDSQILPKIKAVPQLQGYLRSVFALTNGVYPHKLVF.
For Research Use Only | Not For Clinical Use.
Online Inquiry