Mouse Anti-Horse RPS8 Antibody (MO-AB-46392W)
Cat: MO-AB-46392W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO46392W |
Specificity | This antibody binds to Horse RPS8. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Cytosol; Endoplasmic reticulum |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S8E family of ribosomal proteins. It is located in the cytoplasm. Increased expression of this gene in colorectal tumors and colon polyps compared to matched normal colonic mucosa has been observed. This gene is co-transcribed with the small nucleolar RNA genes U38A, U38B, U39, and U40, which are located in its fourth, fifth, first, and second introns, respectively. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. |
Product Overview | Mouse Anti-Horse RPS8 Antibody is a mouse antibody against RPS8. It can be used for RPS8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | 40S ribosomal protein S8; RPS8 |
UniProt ID | F7DW15 |
Protein Refseq | The length of the protein is191 amino acids long. The sequence is show below: RKPYHKKRKYELGRPAANTKIGPRRIHTVRVRGGNKKYRALRLDVGNFSWGSECCTRKTRIIDVVYNASNNELVRTKTLVKNCIVLVDSTPYRQWYESHYALPLGRKKGAKLTPEEEEILNKKRSKKIQKKYDERKKNAKISSLLEEQFQQGKLLACIASRPGQCGRADGYVLEGKELEFYLRKIKARKGK. |
See other products for " rps8 "
MO-AB-01524R | Mouse Anti-Medaka rps8 Antibody (MO-AB-01524R) |
MO-AB-01298L | Mouse Anti-Elephant RPS8 Antibody (MO-AB-01298L) |
MO-AB-00879H | Mouse Anti-Arabidopsis rps8 Antibody (MO-AB-00879H) |
MO-AB-03865Y | Mouse Anti-Chicken RPS8 Antibody (MO-AB-03865Y) |
CBMOAB-09386HCB | Mouse Anti-C. elegans RPS8 Antibody (CBMOAB-09386HCB) |
MO-AB-42497W | Mouse Anti-Guinea pig RPS8 Antibody (MO-AB-42497W) |
MO-AB-33180W | Mouse Anti-Dog RPS8 Antibody (MO-AB-33180W) |
CBMOAB-89258FYB | Mouse Anti-Rice RPS8 Antibody (CBMOAB-89258FYB) |
CBMOAB-30148FYA | Mouse Anti-D. melanogaster Rps8 Antibody (CBMOAB-30148FYA) |
MO-AB-17528Y | Mouse Anti-Sheep RPS8 Antibody (MO-AB-17528Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry