Mouse Anti-Horse TOP2A Antibody (MO-AB-46883W)
Cat: MO-AB-46883W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO46883W |
Specificity | This antibody binds to Horse TOP2A. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromosome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. |
Product Overview | Mouse Anti-Horse TOP2A Antibody is a mouse antibody against TOP2A. It can be used for TOP2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | DNA topoisomerase 2-alpha-like protein; TOP2A |
UniProt ID | L7MRL0 |
Protein Refseq | The length of the protein is98 amino acids long. The sequence is show below: TKKPATKRVKKDPGLNSDVSQKPDMPKTKNPRKRKPSTSDDSDSNLEKMISKAVTNKKSKENDDFHLDLDSAVAPRAKSGRARKPIKYLEESDEDDLF. |
See other products for " TOP2A "
MO-AB-01538L | Mouse Anti-Elephant TOP2A Antibody (MO-AB-01538L) |
MO-AB-43484W | Mouse Anti-Hamsters TOP2A Antibody (MO-AB-43484W) |
MO-AB-42723W | Mouse Anti-Guinea pig TOP2A Antibody (MO-AB-42723W) |
MO-AB-17020W | Mouse Anti-Chimpanzee TOP2A Antibody (MO-AB-17020W) |
MO-AB-35867W | Mouse Anti-Ferret TOP2A Antibody (MO-AB-35867W) |
MO-AB-38781W | Mouse Anti-Gorilla TOP2A Antibody (MO-AB-38781W) |
MO-AB-10281Y | Mouse Anti-Rabbit TOP2A Antibody (MO-AB-10281Y) |
MO-AB-06951Y | Mouse Anti-O. anatinus TOP2A Antibody (MO-AB-06951Y) |
MO-AB-18035Y | Mouse Anti-Sheep TOP2A Antibody (MO-AB-18035Y) |
CBMOAB-60843FYA | Mouse Anti-Rhesus TOP2A Antibody (CBMOAB-60843FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry