Mouse Anti-Horse TOP2A Antibody (MO-AB-46883W)


Cat: MO-AB-46883W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO46883W
SpecificityThis antibody binds to Horse TOP2A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromosome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.
Product OverviewMouse Anti-Horse TOP2A Antibody is a mouse antibody against TOP2A. It can be used for TOP2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA topoisomerase 2-alpha-like protein; TOP2A
UniProt IDL7MRL0
Protein RefseqThe length of the protein is98 amino acids long.
The sequence is show below: TKKPATKRVKKDPGLNSDVSQKPDMPKTKNPRKRKPSTSDDSDSNLEKMISKAVTNKKSKENDDFHLDLDSAVAPRAKSGRARKPIKYLEESDEDDLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry