Mouse Anti-Horse VDAC3 Antibody (MO-AB-47058W)


Cat: MO-AB-47058W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO47058W
SpecificityThis antibody binds to Horse VDAC3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a voltage-dependent anion channel (VDAC), and belongs to the mitochondrial porin family. VDACs are small, integral membrane proteins that traverse the outer mitochondrial membrane and conduct ATP and other small metabolites. They are known to bind several kinases of intermediary metabolism, thought to be involved in translocation of adenine nucleotides, and are hypothesized to form part of the mitochondrial permeability transition pore, which results in the release of cytochrome c at the onset of apoptotic cell death. Alternatively transcript variants encoding different isoforms have been described for this gene.
Product OverviewMouse Anti-Horse VDAC3 Antibody is a mouse antibody against VDAC3. It can be used for VDAC3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUncharacterized protein; Voltage-dependent anion-selective channe protein 3-like protein; VDAC3
UniProt IDF7DT77
Protein RefseqThe length of the protein is283 amino acids long.
The sequence is show below: MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKICNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQLHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNNASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA.
See other products for " vdac3 "
MO-AB-09026HMouse Anti-Frog vdac3 Antibody (MO-AB-09026H)
MO-AB-10460YMouse Anti-Rabbit VDAC3 Antibody (MO-AB-10460Y)
MO-AB-31187RMouse Anti-Pig VDAC3 Antibody (MO-AB-31187R)
CBMOAB-15749FYBMouse Anti-Zebrafish vdac3 Antibody (CBMOAB-15749FYB)
CBMOAB-89807FYBMouse Anti-Rice VDAC3 Antibody (CBMOAB-89807FYB)
MO-DKB-02531WRabbit Anti-VDAC3 Antibody (MO-DKB-02531W)
MO-AB-38395WMouse Anti-Goat VDAC3 Antibody (MO-AB-38395W)
CBMOAB-62069FYAMouse Anti-Rhesus VDAC3 Antibody (CBMOAB-62069FYA)
MO-DKB-02532WRabbit Anti-VDAC3 Antibody (MO-DKB-02532W)
MO-AB-67651WMouse Anti-Marmoset VDAC3 Antibody (MO-AB-67651W)
For Research Use Only | Not For Clinical Use.
Online Inquiry