Mouse Anti-Horse VPS13C Antibody (MO-AB-47062W)
Cat: MO-AB-47062W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO47062W |
Specificity | This antibody binds to Horse VPS13C. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the vacuolar protein sorting-associated 13 gene family. Alternate splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Horse VPS13C Antibody is a mouse antibody against VPS13C. It can be used for VPS13C detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Vacuolar protein sorting-associated protein 13C-like protein; VPS13C |
UniProt ID | L7MRF8 |
Protein Refseq | The length of the protein is67 amino acids long. The sequence is show below: SGNLLQISVKEQGLFHKKDSANQGYLRKIYLLDTTTAERACKAIEDAQSVRHQQKLVKQSSLKLLVP. |
See other products for " VPS13C "
CBMOAB-62117FYA | Mouse Anti-Rhesus VPS13C Antibody (CBMOAB-62117FYA) |
MO-AB-67691W | Mouse Anti-Marmoset VPS13C Antibody (MO-AB-67691W) |
MO-AB-26129W | Mouse Anti-Chimpanzee VPS13C Antibody (MO-AB-26129W) |
MO-AB-31211R | Mouse Anti-Pig VPS13C Antibody (MO-AB-31211R) |
MO-AB-22802R | Mouse Anti-Cattle VPS13C Antibody (MO-AB-22802R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry