AibGenesis™ Mouse Anti-hoxc8a Antibody (CBMOAB-79883FYA)


Cat: CBMOAB-79883FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-79883FYA Monoclonal Zebrafish (Danio rerio), Medaka (Oryzias latipes) WB, ELISA MO79883FYA 100 µg
Inquiry
MO-AB-00710R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00710R 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Medaka (Oryzias latipes)
CloneMO79883FYA
SpecificityThis antibody binds to Zebrafish hoxc8a.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish hoxc8a Antibody is a mouse antibody against hoxc8a. It can be used for hoxc8a detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHomeobox protein Hox-C8a; hoxc8a; hoxc
UniProt IDQ68EH7
Protein RefseqThe length of the protein is 250 amino acids long.
The sequence is show below: MSSYFVNPLFSKYKGGETLEPTYYDCRFPQSVARSHTLVYGHGAAAPGFQHPSHHVQDFFHHGTTGISNPGYQQNPCALACHGDATKFYGYEALPRQPLYGTQQEATLAQYPDCKSSNSTNPGEGQGHLSQNSSPSLMFPWMRPHAPGRRNGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALSLTERQVKIWFQNRRMKWKKENNKDKFPGQRGEAEAEAEEEGNEDGEAEEGEDKETEEKEESKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry