AibGenesis™ Mouse Anti-HPGD Antibody (CBMOAB-44786FYA)


Cat: CBMOAB-44786FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44786FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa) WB, ELISA MO44786FYA 100 µg
MO-AB-04353H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04353C 100 µg
MO-AB-13782R Monoclonal Cattle (Bos taurus) WB, ELISA MO13782R 100 µg
MO-AB-26372R Monoclonal Pig (Sus scrofa) WB, ELISA MO26372R 100 µg
MO-AB-31146W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO31146W 100 µg
MO-AB-41812W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41812W 100 µg
MO-AB-56936W Monoclonal Marmoset WB, ELISA MO56936W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Dog (Canis lupus familiaris), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Marmoset, Pig (Sus scrofa)
CloneMO44786FYA
SpecificityThis antibody binds to Rhesus HPGD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Plasma Membrane; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the short-chain nonmetalloenzyme alcohol dehydrogenase protein family. The encoded enzyme is responsible for the metabolism of prostaglandins, which function in a variety of physiologic and cellular processes such as inflammation. Mutations in this gene result in primary autosomal recessive hypertrophic osteoarthropathy and cranioosteoarthropathy. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus HPGD Antibody is a mouse antibody against HPGD. It can be used for HPGD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHPGD
UniProt IDF6U1R8
Protein RefseqThe length of the protein is 266 amino acids long.
The sequence is show below: MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEKFEPQKTLFIQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLDYMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNAICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNGAIMKITTSKGIHFQDYDATPFQAKSQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry