Mouse Anti-HPRT Antibody (MO-AB-13784R)
Cat: MO-AB-13784R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-13784R | Monoclonal | Cattle (Bos taurus), Cat (Felis catus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Rabbit (Oryctolagus cuniculus), Frog (Xenopus), Zebrafish (Danio rerio), Sheep (Ovis aries) | WB, ELISA | MO13784R | 100 µg | ||
| CBMOAB-00311FYA | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, IHC, IP | F00311FYA | 100 µg | ||
| MO-AB-07374W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO07374W | 100 µg | ||
| MO-AB-31148W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO31148W | 100 µg | ||
| MO-AB-34901W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34901W | 100 µg | ||
| MO-AB-45048W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45048W | 100 µg | ||
| MO-AB-26374R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26374R | 100 µg | ||
| MO-AB-04356H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04356C | 100 µg | ||
| MO-AB-08389Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08389Y | 100 µg | ||
| MO-AB-15671Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15671Y | 100 µg | ||
| MO-DKB-03164W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Dog (Canis lupus familiaris), Chicken (Gallus gallus), Primate, Rabbit (Oryctolagus cuniculus), Frog (Xenopus), Zebrafish (Danio rerio) | WB, IF, IHC, IHC-P | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Cat (Felis catus), Dog (Canis lupus familiaris), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Chicken (Gallus gallus), Primate, Rabbit (Oryctolagus cuniculus), Frog (Xenopus), Zebrafish (Danio rerio), Sheep (Ovis aries) |
| Clone | MO13784R |
| Specificity | This antibody binds to Cattle HPRT. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Product Overview | Mouse Anti-Cattle HPRT Antibody is a mouse antibody against HPRT. It can be used for HPRT detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Hypoxanthine phosphoribosyltransferase, Fragment; HPRT |
| UniProt ID | Q9GJT9 |
| Protein Refseq | The length of the protein is 186 amino acids long. The sequence is show below: PGYDLNLFCIPNHYAEDLEKVFIPHGLIMDRTERLARDVMKEMGGHHIVALCALKGGYKFFADLLDYIKALNRNSDKSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLALVKKHKPKMVKVASLLMKRTPRSVGYKPDFVGFEIPDKFVVGYALDYNEYSR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry