Mouse Anti-HPX Antibody (CBMOAB-44808FYA)


Cat: CBMOAB-44808FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44808FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO44808FYA 100 µg
CBMOAB-79940FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79940FYA 100 µg
MO-AB-08391Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08391Y 100 µg
MO-AB-13796R Monoclonal Cattle (Bos taurus) WB, ELISA MO13796R 100 µg
MO-AB-26385R Monoclonal Pig (Sus scrofa) WB, ELISA MO26385R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO44808FYA
SpecificityThis antibody binds to Rhesus HPX.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Extracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a plasma glycoprotein that binds heme with high affinity. The encoded protein is an acute phase protein that transports heme from the plasma to the liver and may be involved in protecting cells from oxidative stress.
Product OverviewMouse Anti-Rhesus HPX Antibody is a mouse antibody against HPX. It can be used for HPX detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHPX
UniProt IDF7C9A4
Protein RefseqThe length of the protein is 462 amino acids long.
The sequence is show below: MARALGAPVALGLWSLCWSLAIANPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWARELISETWKNFTSPVDAAFRHGHQSVFLIKGDKVWVYPPEKKEKGYPKLLQDKFPGIPSPLDAAVECHRGECQAEGILFFQGDHKWFWDLATGTMKKRYWSAVGNCSSALRWLGRYYCFQGNQFLRFNPVTGEVPPRYPLDVRDYFMPCPGRGHGHRNGTGHGNGTHHGPEYMRCSPHLVLSALMSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSTVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGSPHGIILDSVDAAFVCPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCVEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKSPPQPQKVTSLLGCTY.
For Research Use Only | Not For Clinical Use.
Online Inquiry