Mouse Anti-HRASLS5 Antibody (CBMOAB-44816FYA)


Cat: CBMOAB-44816FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44816FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO44816FYA 100 µg
MO-AB-13802R Monoclonal Cattle (Bos taurus) WB, ELISA MO13802R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO44816FYA
SpecificityThis antibody binds to Rhesus HRASLS5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHRASLS5 (HRAS Like Suppressor Family Member 5) is a Protein Coding gene. Diseases associated with HRASLS5 include Poland Syndrome and Myasthenic Syndrome, Congenital, 5. Among its related pathways are Metabolism and Acyl chain remodelling of PE. Gene Ontology (GO) annotations related to this gene include transferase activity, transferring acyl groups. An important paralog of this gene is PLA2G16.
Product OverviewMouse Anti-Rhesus HRASLS5 Antibody is a mouse antibody against HRASLS5. It can be used for HRASLS5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHRASLS5
UniProt IDF7HFF4
Protein RefseqThe length of the protein is 269 amino acids long.
The sequence is show below: MGLSPGARGKYAPRLPRIPPPRPKPASRTAGTGRKDQQPAPRRSTVPHSEESVGSAALVQLPAKQPRPGTLEQGRSIQQGEKPVVSLETTLSQKADWSSIPKPENKGKLIKQAAEGKPRPRPGDLIEIFRIGYEHWAIYVEDDCVVHLAPPSEEFEVGSISSIFSNRAVVKYSRLEDVLHGCSWKVNNKLDGTYLPLPVDKIIQRTKKMVNKTVQYSLIEGNCEHFVNGLRYGVPRSQQVEHALMEGAKAAGAVISAVVDSIKPKPITA.
For Research Use Only | Not For Clinical Use.
Online Inquiry