Mouse Anti-HS3ST1 Antibody (CBMOAB-44825FYA)


Cat: CBMOAB-44825FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44825FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) WB, ELISA MO44825FYA 100 µg
CBMOAB-79959FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO79959FYA 100 µg
MO-AB-00631L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00631L 100 µg
MO-AB-02335Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02335Y 100 µg
MO-AB-04364H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04364C 100 µg
MO-AB-06556Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06556Y 100 µg
MO-AB-08399Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08399Y 100 µg
MO-AB-09602W Monoclonal Cat (Felis catus) WB, ELISA MO09602W 100 µg
MO-AB-10756W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO10756W 100 µg
MO-AB-13811R Monoclonal Cattle (Bos taurus) WB, ELISA MO13811R 100 µg
MO-AB-15674Y Monoclonal Sheep (Ovis aries) WB, ELISA MO15674Y 100 µg
MO-AB-26390R Monoclonal Pig (Sus scrofa) WB, ELISA MO26390R 100 µg
MO-AB-33298H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO33298C 100 µg
MO-AB-34903W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34903W 100 µg
MO-AB-41819W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41819W 100 µg
MO-AB-45053W Monoclonal Horse (Equus caballus) WB, ELISA MO45053W 100 µg
MO-AB-56966W Monoclonal Marmoset WB, ELISA MO56966W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio)
CloneMO44825FYA
SpecificityThis antibody binds to Rhesus HS3ST1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHeparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein.
Product OverviewMouse Anti-Rhesus HS3ST1 Antibody is a mouse antibody against HS3ST1. It can be used for HS3ST1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSulfotransferase; EC 2.8.2.-; HS3ST1
UniProt IDH9ZG39
Protein RefseqThe length of the protein is 307 amino acids long.
The sequence is show below: MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRYGAAANGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYGHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVHSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKRKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH.
For Research Use Only | Not For Clinical Use.
Online Inquiry