Mouse Anti-HS3ST1 Antibody (CBMOAB-44825FYA)
Cat: CBMOAB-44825FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
CBMOAB-44825FYA | Monoclonal | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO44825FYA | 100 µg | ||
CBMOAB-79959FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO79959FYA | 100 µg | ||
MO-AB-00631L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00631L | 100 µg | ||
MO-AB-02335Y | Monoclonal | Chicken (Gallus gallus) | WB, ELISA | MO02335Y | 100 µg | ||
MO-AB-04364H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04364C | 100 µg | ||
MO-AB-06556Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06556Y | 100 µg | ||
MO-AB-08399Y | Monoclonal | Rabbit (Oryctolagus cuniculus) | WB, ELISA | MO08399Y | 100 µg | ||
MO-AB-09602W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09602W | 100 µg | ||
MO-AB-10756W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO10756W | 100 µg | ||
MO-AB-13811R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO13811R | 100 µg | ||
MO-AB-15674Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO15674Y | 100 µg | ||
MO-AB-26390R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO26390R | 100 µg | ||
MO-AB-33298H | Monoclonal | Nile tilapia (Oreochromis niloticus) | WB, ELISA | MO33298C | 100 µg | ||
MO-AB-34903W | Monoclonal | Ferret (Mustela Putorius Furo) | WB, ELISA | MO34903W | 100 µg | ||
MO-AB-41819W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41819W | 100 µg | ||
MO-AB-45053W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO45053W | 100 µg | ||
MO-AB-56966W | Monoclonal | Marmoset | WB, ELISA | MO56966W | 100 µg |
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), O. anatinus (Ornithorhynchus anatinus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
Clone | MO44825FYA |
Specificity | This antibody binds to Rhesus HS3ST1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It possesses both heparan sulfate glucosaminyl 3-O-sulfotransferase activity, anticoagulant heparan sulfate conversion activity, and is a rate limiting enzyme for synthesis of anticoagulant heparan. This enzyme is an intraluminal Golgi resident protein. |
Product Overview | Mouse Anti-Rhesus HS3ST1 Antibody is a mouse antibody against HS3ST1. It can be used for HS3ST1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Sulfotransferase; EC 2.8.2.-; HS3ST1 |
UniProt ID | H9ZG39 |
Protein Refseq | The length of the protein is 307 amino acids long. The sequence is show below: MAALLLGAVLLVAQPQLVPSRPAELGQQELLRKAGTLQDDVRYGAAANGSAQQLPQTIIIGVRKGGTRALLEMLSLHPDVAAAENEVHFFDWEEHYGHGLGWYLSQMPFSWPHQLTVEKTPAYFTSPKVPERVHSMNPSIRLLLILRDPSERVLSDYTQVFYNHMQKRKPYPSIEEFLVRDGRLNVDYKALNRSLYHVHMQNWLRFFPLRHIHIVDGDRLIRDPFPEIQKVERFLKLSPQINASNFYFNKTKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELVGRTFDWH. |
For Research Use Only | Not For Clinical Use.
Online Inquiry