AibGenesis™ Mouse Anti-HSPCB Antibody (CBMOAB-44904FYA)


Cat: CBMOAB-44904FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44904FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa) WB, ELISA MO44904FYA 100 µg
MO-AB-26413R Monoclonal Pig (Sus scrofa) WB, ELISA MO26413R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa)
CloneMO44904FYA
SpecificityThis antibody binds to Rhesus HSPCB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HSPCB Antibody is a mouse antibody against HSPCB. It can be used for HSPCB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHeat shock 90kDa protein 1, beta; HSPCB
UniProt IDQ3YAN8
Protein RefseqThe length of the protein is 142 amino acids long.
The sequence is show below: LEERRVKEVVKKHSQFIGYPITLYLKKEREKEISGDEAEEEKGEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLF.
For Research Use Only | Not For Clinical Use.
Online Inquiry