Mouse Anti-HTR1B Antibody (CBMOAB-44927FYA)


Cat: CBMOAB-44927FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44927FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio) WB, ELISA MO44927FYA 100 µg
CBMOAB-80143FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO80143FYA 100 µg
MO-AB-02361Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO02361Y 100 µg
MO-AB-08281W Monoclonal Cat (Felis catus) WB, ELISA MO08281W 100 µg
MO-AB-08417Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO08417Y 100 µg
MO-AB-13899R Monoclonal Cattle (Bos taurus) WB, ELISA MO13899R 100 µg
MO-AB-41827W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41827W 100 µg
MO-AB-45075W Monoclonal Horse (Equus caballus) WB, ELISA MO45075W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Guinea pig (Cavia porcellus), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio)
CloneMO44927FYA
SpecificityThis antibody binds to Rhesus HTR1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this intronless gene is a G-protein coupled receptor for serotonin (5-hydroxytryptamine). Ligand binding activates second messengers that inhibit the activity of adenylate cyclase and manage the release of serotonin, dopamine, and acetylcholine in the brain. The encoded protein may be involved in several neuropsychiatric disorders and therefore is often a target of antidepressant and other psychotherapeutic drugs.
Product OverviewMouse Anti-Rhesus HTR1B Antibody is a mouse antibody against HTR1B. It can be used for HTR1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSerotonin receptor type 1B; HTR1B
UniProt IDX2CFC5
Protein RefseqThe length of the protein is 390 amino acids long.
The sequence is show below: MEEPGAQCAPPPPAGSETWAPQANLSSAPSQNCSTKDYIYQDSIALPWKVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPVSTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISISLPPFFWRQAKAEEEVSDCVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALXERKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVLPICKDACWFHLAIFDFFTWLGYLNSLINPIIYTMSNEDFKQAFHKLIRFKCTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry