Mouse Anti-HTR1E Antibody (CBMOAB-44930FYA)


Cat: CBMOAB-44930FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44930FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset WB, ELISA MO44930FYA 100 µg
MO-AB-04413H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04413C 100 µg
MO-AB-20871W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20871W 100 µg
MO-AB-57045W Monoclonal Marmoset WB, ELISA MO57045W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset
CloneMO44930FYA
SpecificityThis antibody binds to Rhesus HTR1E.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HTR1E Antibody is a mouse antibody against HTR1E. It can be used for HTR1E detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names5-hydroxytryptamine receptor 1E; HTR1E
UniProt IDH9FKS9
Protein RefseqThe length of the protein is 110 amino acids long.
The sequence is show below: GSSRHLSNRSTDSQNSFANCKLTQTFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAFILSWLPFFIKELIVGLSIYTVSSEVA.
For Research Use Only | Not For Clinical Use.
Online Inquiry