Mouse Anti-HTR1F Antibody (CBMOAB-44931FYA)


Cat: CBMOAB-44931FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-44931FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Pig (Sus scrofa) WB, ELISA MO44931FYA 100 µg
MO-AB-14818W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO14818W 100 µg
MO-AB-26418R Monoclonal Pig (Sus scrofa) WB, ELISA MO26418R 100 µg
MO-AB-41829W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41829W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Guinea pig (Cavia porcellus), Pig (Sus scrofa)
CloneMO44931FYA
SpecificityThis antibody binds to Rhesus HTR1F.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus HTR1F Antibody is a mouse antibody against HTR1F. It can be used for HTR1F detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesHTR1F
UniProt IDF7BWT2
Protein RefseqThe length of the protein is 366 amino acids long.
The sequence is show below: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANYLICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALDRYRAITDAVEYARKRTPKHAGIMITVVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIVSTIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRISKEEVNGQVLLESGEKSAKSVSTPYAPEKTLTDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILGAFVICWLPFFVKELVVNVCEKCKISEEMSNFLTWLGYLNSLINPLIYTIFNEDFKKAFQKLVRCRC.
For Research Use Only | Not For Clinical Use.
Online Inquiry